PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA03G11070.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family LBD
Protein Properties Length: 322aa    MW: 33533.9 Da    PI: 8.2854
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA03G11070.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260118.24.9e-3737123186
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeq.pkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqq 86 
                      +C aCk+lrrkC+++C++apyf +eq +++fa+vhk+FGasnv+kll ++p ++r+da+ +++yeA+ar+rdPvyG+v++i++lqqq
  ONIVA03G11070.1  37 PCGACKFLRRKCVSGCIFAPYFDSEQgAAHFAAVHKVFGASNVSKLLLQIPAHKRPDAVVTICYEAQARLRDPVYGCVAHIFALQQQ 123
                      7***********************9989**********************************************************9 PP

2DUF26045.62.1e-1414018456100
           DUF260  56 damsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                      da+ +++yeA+ar+rdPvyG+v++i++lqqq+ +l+ael +l+++
  ONIVA03G11070.1 140 DAVVTICYEAQARLRDPVYGCVAHIFALQQQVVNLQAELTYLQAH 184
                      7999************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089120.64736138IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-3637124IPR004883Lateral organ boundaries, LOB
PfamPF031952.7E-12140182IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010089Biological Processxylem development
GO:0010311Biological Processlateral root formation
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MSSGGGASSA LGGGGGGGGS GGGGGGPSGG GGGGGGPCGA CKFLRRKCVS GCIFAPYFDS  60
EQGAAHFAAV HKVFGASNVS KLLLQIPAHK RPDAVVTICY EAQARLRDPV YGCVAHIFAL  120
QQQFLRRKCV SGCIFAPYSD AVVTICYEAQ ARLRDPVYGC VAHIFALQQQ VVNLQAELTY  180
LQAHLATLEL PSPPPLMPAP PQMPMPAPFS ISDLPSSTSV PTTVDLSALF DPPPQPQWAS  240
PLQQQQQHHH QHHHHQQQQH QLRQPSYATL ARAPSGMTAA AESSGGGGGG GGGDLQALAR  300
ELLDRHRSAV KLEQPPPPHS RS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1186720.0AC118672.3 Genomic sequence for Oryza sativa, Nipponbare strain, clone OSJNBb0078P24, from chromosome 3, complete sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
GenBankCP0126110.0CP012611.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 3 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629413.11e-118PREDICTED: LOB domain-containing protein 30
TrEMBLA0A0E0GJP40.0A0A0E0GJP4_ORYNI; Uncharacterized protein
STRINGBGIOSGA011118-PA1e-117(Oryza sativa Indica Group)
STRINGLOC_Os03g14270.11e-117(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP33463782
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00220.14e-60LBD family protein